PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G457300.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 735aa    MW: 82619.3 Da    PI: 7.1652
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G457300.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.61.8e-1193597301374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++ L++cA+av+++d + a++lL+++++++ p+gd  qRla++f+ +L+arla+++s+ly++l +++t+    s+ l+a++l+  ++P+ 
  Sevir.9G457300.3.p 359 LRTILIHCAQAVAADDRRTANELLKQIRHHSKPNGDGAQRLAHCFADGLEARLAGTGSQLYHKLVAKRTT---ASDMLKAYHLYLAACPFK 446
                         5789************************************************************999999...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         ++sh++ Nq+Il  ++++++vHiiDf+i  G+QWp+L++ L++R++gpp lRiTg++ p++g   +e++eetg+rLa++A++++vpfe++ 
  Sevir.9G457300.3.p 447 RLSHFLSNQTILSMIKNASKVHIIDFGIYFGFQWPCLIRRLSKREGGPPVLRITGIDVPQPGfrPTERIEETGQRLAEYAKKFNVPFEYQG 537
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +a+++e++++e+L++ ++E+++Vn+ ++  +l de+v+++s+r++vL+++++++P ++++   + +++ + F +rf eal ++salfd+l
  Sevir.9G457300.3.p 538 -IASKWETIRVEDLKIGKDEVVIVNCLYRFRNLIDETVAVDSPRNRVLNTIRQVNPAIFIHGIVNGSYSVPFFITRFREALFHFSALFDML 627
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         e+++pr++ +r+ +Er l+gre+ nv+aceg++r+er et+++W+ r  +aGF + pl+++++++ak  ++ ++ + + ++e+sg+l++gW
  Sevir.9G457300.3.p 628 ETTVPRDDAQRALIERDLFGREALNVIACEGSDRVERPETYKQWQVRNLRAGFVQSPLNQEIVMKAKDKVKDIYHKDFVIDEDSGWLLQGW 718
                         **************************************************************************888************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r ++++S W+
  Sevir.9G457300.3.p 719 KGRIIYAISTWK 730
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.626333710IPR005202Transcription factor GRAS
PfamPF035146.2E-117359730IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MGLDNTYGEL SGMFCGGLSY DGYADHSSSS DYFRFIDPLP AVVPQIAAEP YSNPSSTVSR  60
ANTETDNPED WEFISDESLN YISRMLMEED IDEKCSMYQA ESAALRAAAK PFYDILGHKF  120
PPSPDHQLTP WSVDSPSESG SSSRTQSVAS TVTSSSVGGA VDSNRRYDAG RSGQMESYRG  180
LCGQSSQPLV GPSSDACSAA GVLEDPLITN GRIPEYLFES LPTWDFRRGI EEAQKFLPVR  240
NKLVIDLEAG GVARPQEARK DVSLNARKAD VLNSRKNRQS EDLDLMEGRN IKQSAFCSDE  300
PDWIEMFDDL LRQTEKKATD LRELMRNEAS KNSQVTQTKG PSGPRTRGRK PTKKDVVDLR  360
TILIHCAQAV AADDRRTANE LLKQIRHHSK PNGDGAQRLA HCFADGLEAR LAGTGSQLYH  420
KLVAKRTTAS DMLKAYHLYL AACPFKRLSH FLSNQTILSM IKNASKVHII DFGIYFGFQW  480
PCLIRRLSKR EGGPPVLRIT GIDVPQPGFR PTERIEETGQ RLAEYAKKFN VPFEYQGIAS  540
KWETIRVEDL KIGKDEVVIV NCLYRFRNLI DETVAVDSPR NRVLNTIRQV NPAIFIHGIV  600
NGSYSVPFFI TRFREALFHF SALFDMLETT VPRDDAQRAL IERDLFGREA LNVIACEGSD  660
RVERPETYKQ WQVRNLRAGF VQSPLNQEIV MKAKDKVKDI YHKDFVIDED SGWLLQGWKG  720
RIIYAISTWK PKNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-493637308375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0611760.0BT061176.1 Zea mays full-length cDNA clone ZM_BFb0119A04 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984720.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_004984721.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK4A6B30.0K4A6B3_SETIT; Uncharacterized protein
STRINGSi034417m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein